>2dsp_B mol:protein length:92  Insulin-like growth factor-binding protein 4
DEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYTPRCGSGLRC
YPPRGVEKPLHTLMHGQGVCMELAEIEAIQESL
>2dsp_I mol:protein length:70  Insulin-like growth factor IB
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEM
YCAPLKPAKSA
>2dsp_I mol:protein length:70  Insulin-like growth factor IB
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEM
YCAPLKPAKSA