>2dsp_I mol:protein length:70  Insulin-like growth factor IB
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEM
YCAPLKPAKSA