>2e7g_A mol:protein length:129  Putative ribosome-binding factor A
GSSGSSGRKEDHARLRALNGLLYKALTDLLCTPEVSQELYDLNVELSKVSLTPDFSACR
AYWKTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNVPPIVFVQDKGNAALAELDQL
LAVADSGPSSG