>2eh0_A mol:protein length:130  Kinesin-like protein KIF1B
GSSGSSGTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERRQDIVLSGAHIKEEHCI
FRSERSNSGEVIVTLEPCERSETYVNGKRVSQPVQLRSGNRIIMGKNHVFRFNHPEQAR
AEREKTSGPSSG