>2err_A mol:protein length:109  Ataxin-2-binding protein 1
MGSSHHHHHHSSGLVPRGSHMNTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDV
EIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVM