>2f1x_A mol:protein length:161  HAUSP/USP7
GSHMNTAEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYP
DRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWG
FSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPGGSRAHSSH