>2f1x_B mol:protein length:161  HAUSP/USP7
GSHMNTAEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYP
DRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWG
FSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPGGSRAHSSH