>2fl0_F mol:protein length:155  Bacterioferritin
MKGDKIVIQHLNKILGNELIAINQYFLHARMYEDWGLEKLGKHEYHESIDEMKHADKLI
KRILFLEGLPNLQELGKLLIGEHTKEMLECDLKLEQAGLPDLKAAIAYCESVGDYASRE
LLEDILESEEDHIDWLETQLDLIDKIGLENYLQSQMD