>2gtp_C mol:protein length:145  Regulator of G-protein signaling 1
SMSGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACE
DYKKTESDLLPCKAEEIYKAFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVI
YTLMEKDSYPRFLKSDIYLNLLNDLQA