>2idw_A mol:protein length:99  Protease
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQY
DQIIIEIAGHKAIGTVLVGPTPANIIGRNLLTQIGATLNF
>2idw_B mol:protein length:99  Protease
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQY
DQIIIEIAGHKAIGTVLVGPTPANIIGRNLLTQIGATLNF
>2idw_B mol:protein length:99  Protease
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQY
DQIIIEIAGHKAIGTVLVGPTPANIIGRNLLTQIGATLNF