>2ihb_B mol:protein length:153  Regulator of G-protein signalling 10
SMSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEE
NVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPL
MFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEE