>2kbx_A mol:protein length:171  Integrin-linked protein kinase
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGAR
INVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAED
LVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKG
>2kbx_B mol:protein length:70  LIM and senescent cell antigen-like-containing domain protein 1
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC
EHDFQMLFAPC
>2kbx_B mol:protein length:70  LIM and senescent cell antigen-like-containing domain protein 1
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC
EHDFQMLFAPC