>2kbx_B mol:protein length:70  LIM and senescent cell antigen-like-containing domain protein 1
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC
EHDFQMLFAPC