>2lp8_A mol:protein length:185  Bcl-2-like protein 1
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFEL
RYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKE
MQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERLEHHHHHH
LEHHHHHH
>2lp8_B mol:protein length:18  Bcl-2 homologous antagonist/killer
XGCVGRALAAFGDCINRX
>2lp8_B mol:protein length:18  Bcl-2 homologous antagonist/killer
XGCVGRALAAFGDCINRX