>2n10_A mol:protein length:60  Unconventional myosin-VI
GPLGSPNSGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKK
R