>2nz6_A mol:protein length:316  Receptor-type tyrosine-protein phosphatase eta
MHHHHHHSSGVDLGTENLYFQSMKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGIS
QPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQ
GPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEI
VLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPP
ESPILVHSSAGVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVF
LNQCVLDIVRSQKDSKVDLIY
>2nz6_A mol:protein length:316  Receptor-type tyrosine-protein phosphatase eta
MHHHHHHSSGVDLGTENLYFQSMKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGIS
QPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQ
GPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEI
VLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPP
ESPILVHSSAGVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVF
LNQCVLDIVRSQKDSKVDLIY