>2o94_B mol:protein length:112  Histone deacetylase 4
GSSHHHHHHSSGLVPRGSHMAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQFEQL
SRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQ
>2o94_C mol:protein length:112  Histone deacetylase 4
GSSHHHHHHSSGLVPRGSHMAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQFEQL
SRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQ
>2o94_D mol:protein length:112  Histone deacetylase 4
GSSHHHHHHSSGLVPRGSHMAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQFEQL
SRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQ
>2o94_D mol:protein length:112  Histone deacetylase 4
GSSHHHHHHSSGLVPRGSHMAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQFEQL
SRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQ
>2o94_A mol:protein length:112  Histone deacetylase 4
GSSHHHHHHSSGLVPRGSHMAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQFEQL
SRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQ