>2o94_A mol:protein length:112  Histone deacetylase 4
GSSHHHHHHSSGLVPRGSHMAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQFEQL
SRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQ