>2owi_A mol:protein length:151  Regulator of G-protein signaling 18
SMVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQI
HLKAKAIYEKFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYT
RFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNE