>2siv_F mol:protein length:36  SIV GP41 GLYCOPROTEIN
XWQEWERKVDFLEENITALLEEAQIQQEKNMYELQX
>2siv_A mol:protein length:38  SIV GP41 GLYCOPROTEIN
XAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTX
>2siv_B mol:protein length:36  SIV GP41 GLYCOPROTEIN
XWQEWERKVDFLEENITALLEEAQIQQEKNMYELQX
>2siv_C mol:protein length:38  SIV GP41 GLYCOPROTEIN
XAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTX
>2siv_D mol:protein length:36  SIV GP41 GLYCOPROTEIN
XWQEWERKVDFLEENITALLEEAQIQQEKNMYELQX
>2siv_E mol:protein length:38  SIV GP41 GLYCOPROTEIN
XAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTX
>2siv_F mol:protein length:36  SIV GP41 GLYCOPROTEIN
XWQEWERKVDFLEENITALLEEAQIQQEKNMYELQX