>2ux2_C mol:protein length:78  CD59 GLYCOPROTEIN
MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENE
LTYYCCKKDLCNFNEQLEN
>2ux2_C mol:protein length:78  CD59 GLYCOPROTEIN
MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENE
LTYYCCKKDLCNFNEQLEN
>2ux2_B mol:protein length:78  CD59 GLYCOPROTEIN
MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENE
LTYYCCKKDLCNFNEQLEN
>2ux2_A mol:protein length:78  CD59 GLYCOPROTEIN
MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENE
LTYYCCKKDLCNFNEQLEN