>2ux2_A mol:protein length:78  CD59 GLYCOPROTEIN
MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENE
LTYYCCKKDLCNFNEQLEN