>2w2m_A mol:protein length:312  PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEE
DGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEF
IRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPAS
APEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQA
AAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPS
THGAAGTAAASHHHHHH
>2w2m_P mol:protein length:114  PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
MKGSKGSKGSKPMSAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARR
LQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
>2w2m_E mol:protein length:107  LOW-DENSITY LIPOPROTEIN RECEPTOR
MKHHHHHHPMSDYDIPTTENLYFQGAMGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQ
LVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACK
>2w2m_P mol:protein length:114  PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
MKGSKGSKGSKPMSAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARR
LQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ