>2ypt_D mol:protein length:482  CAAX PRENYL PROTEASE 1 HOMOLOG
MGMWASLDALWEMPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIM
DSETFEKSRLYQLDKSTFSFWSGLYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEY
EITQSLVFLLLATLFSALAGLPWSLYNTFVIEEKHGFNQQTLGFFMKDAIKKFVVTQCI
LLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKE
EIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQ
EDSGMEPRNEEEGNSEEIKAKVKNKKQGCKNEEVLAVLGHALGHWKLGHTVKNIIISQM
NSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRR
FEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALKTM
KQHAENLYFQ