>3bp7_A mol:protein length:276  HLA class I histocompatibility antigen, B-27 alpha chain
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEY
WDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAY
DGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKE
TLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPA
GDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP