>3db3_A mol:protein length:161  E3 ubiquitin-protein ligase UHRF1
GMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVI
YHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAE
ISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGE
>3db3_B mol:protein length:6  Trimethylated histone H3-K9 peptide
TARKST
>3db3_B mol:protein length:6  Trimethylated histone H3-K9 peptide
TARKST