>3fia_A mol:protein length:121  Intersectin-1
MGHHHHHHSHVAQFPTPFGGSLDTWAITVEERAKHDQQFHSLKPISGFITGDQARNFFF
QSGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVA
ISS
>3fia_A mol:protein length:121  Intersectin-1
MGHHHHHHSHVAQFPTPFGGSLDTWAITVEERAKHDQQFHSLKPISGFITGDQARNFFF
QSGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVA
ISS