>3gg0_B mol:protein length:413  Klebsiella pneumoniae BlrP1
ISEFGSSRMLTTLIYRSQVHPDRPPVDLDALVHRASSKNLPLGITGILLFNGLQFFQVL
EGTEEALESLFSEIQSDPRHRDVVELMRDYSAYRRFHGTGMRILDLRLFETDGALEEIL
RFSTFGVTEPVNDRMFRLLSAFIADGGRYCLPEPLQPSRWMMMPASGTAAPQHLPGQPC
QFALQAIVEPAKKRVSSFEALIRSPTGGSPVEMFAAIAAEDRYRFDLESKAYAFALAGQ
LPLGKHQLAINLLPGSLYHHPDAVGWLMDSLLAAGLRPDQVLIEVTETEVITCFDQFRK
VLKALRVAGMKLAIDDFGAGYSGLSLLTRFQPDKIKVDAELVRDIHISGTKQAIVASVV
RCCEDLGITVVAEGVETLEEWCWLQSVGIRLFQGFLFSRPCLNGIGEICWPVARQAMDL