>3gni_B mol:protein length:389  STRAD alpha
MAHHHHHHMENLYFQGMSSFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRR
INLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLIC
THFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLS
MISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVP
FKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNG
DSPSHPYHRTFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRP
VTPITNFEGSQSQDHSGIFGLVTNLEELEVDDWEF