>3gyq_B mol:protein length:272  rRNA (adenosine-2'-O-)-methyltransferase
GSHMTELDTIANPSDPAVQRIIDVTKPSRSNIKTTLIEDVEPLMHSIAAGVEFIEVYGS
DSSPFPSELLDLCGRQNIPVRLIDSSIVNQLFKGERKAKTFGIARVPRPARFGDIASRR
GDVVVLDGVKIVGNIGAIVRTSLALGASGIILVDSDITSIADRRLQRASRGYVFSLPVV
LSGREEAIAFIRDSGMQLMTLKADGDISVKELGDNPDRLALLFGSEKGGPSDLFEEASS
ASVSIPMMSQTESLNVSVSLGIALHERIDRNLAANR