>3h2v_H mol:protein length:74  Raver-1
HMRKILIRGLPGDVTNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGEQAEAAINAFHQ
SRLRERELSVQLQPT