>3j9m_U mol:protein length:153  uL23m
MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEG
IYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESP
EGSAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL