>3j9m_Z mol:protein length:161  uL30m
MAGILRLVVQWPPGRLQTVTKGVESLICTDWIRHKFTRSRIPEKVFQASPEDHEKYGGD
PQNPHKLHIVTRIKSTRRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIR
IKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES