>3j9m_b mol:protein length:155  mL43
MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNP
GVVIYVNSRPCCVPRVVAEYLNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKP
FHTDNPSIQGQWHPFTNKPTTFRGLRPREVQDPAPAQ