>3j9m_o mol:protein length:102  mL63
MFLTALLWRGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQE
RGHAAVRRREAFEAIKAAATSKFPPHRFIADQLDHLNVTKKWS