>3j9m_q mol:protein length:222  mL64 (CRIF1)
MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAK
QFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRRERE
QHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQE
LLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS