>3lnx_B mol:protein length:96  Tyrosine-protein phosphatase non-receptor type 13
PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVL
AVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
>3lnx_E mol:protein length:96  Tyrosine-protein phosphatase non-receptor type 13
PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVL
AVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
>3lnx_C mol:protein length:96  Tyrosine-protein phosphatase non-receptor type 13
PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVL
AVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
>3lnx_A mol:protein length:96  Tyrosine-protein phosphatase non-receptor type 13
PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVL
AVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
>3lnx_D mol:protein length:96  Tyrosine-protein phosphatase non-receptor type 13
PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVL
AVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
>3lnx_F mol:protein length:96  Tyrosine-protein phosphatase non-receptor type 13
PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVL
AVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
>3lnx_F mol:protein length:96  Tyrosine-protein phosphatase non-receptor type 13
PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVL
AVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT