>3lnx_D mol:protein length:96  Tyrosine-protein phosphatase non-receptor type 13
PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVL
AVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT