>3rk3_B mol:protein length:65  Syntaxin 1a
GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERA
VSDTKK
>3rk3_C mol:protein length:81  SNAP25
GSHMMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVE
EGMNHINQDMKEAEKNLKDLGW
>3rk3_A mol:protein length:37  Vamp2
GPLGSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL
>3rk3_E mol:protein length:63  Complexin-1
GPLGSKLPDAAKKFEEAQEALRQAEEERKAKYAKMEAEREAVRQGIRDKYGIKKKEERE
AEAQ
>3rk3_D mol:protein length:65  SNAP25
GSARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQ
RATKML
>3rk3_E mol:protein length:63  Complexin-1
GPLGSKLPDAAKKFEEAQEALRQAEEERKAKYAKMEAEREAVRQGIRDKYGIKKKEERE
AEAQ