>3rnt_A mol:protein length:104  RIBONUCLEASE T1
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEW
PILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
>3rnt_A mol:protein length:104  RIBONUCLEASE T1
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEW
PILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT