>3t6a_D mol:protein length:333  Breast cancer anti-estrogen resistance protein 3
MGEFVTPLLETVSSFRPNEFESKFLPPENKPLETALLKRAKELFTNNDPKVIAQHVLSM
DCRVARILGVSEEMRRNMGVSSGLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTG
TLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQITRLEKTWTALRHQYTQTA
ILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQS
CEIMLNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKTEFQMRLLWGSKGAQV
NQTERYEKFNQILTALSRKLEPPPVKQAELLEHHHHHH
>3t6a_B mol:protein length:333  Breast cancer anti-estrogen resistance protein 3
MGEFVTPLLETVSSFRPNEFESKFLPPENKPLETALLKRAKELFTNNDPKVIAQHVLSM
DCRVARILGVSEEMRRNMGVSSGLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTG
TLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQITRLEKTWTALRHQYTQTA
ILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQS
CEIMLNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKTEFQMRLLWGSKGAQV
NQTERYEKFNQILTALSRKLEPPPVKQAELLEHHHHHH
>3t6a_C mol:protein length:333  Breast cancer anti-estrogen resistance protein 3
MGEFVTPLLETVSSFRPNEFESKFLPPENKPLETALLKRAKELFTNNDPKVIAQHVLSM
DCRVARILGVSEEMRRNMGVSSGLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTG
TLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQITRLEKTWTALRHQYTQTA
ILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQS
CEIMLNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKTEFQMRLLWGSKGAQV
NQTERYEKFNQILTALSRKLEPPPVKQAELLEHHHHHH
>3t6a_A mol:protein length:333  Breast cancer anti-estrogen resistance protein 3
MGEFVTPLLETVSSFRPNEFESKFLPPENKPLETALLKRAKELFTNNDPKVIAQHVLSM
DCRVARILGVSEEMRRNMGVSSGLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTG
TLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQITRLEKTWTALRHQYTQTA
ILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQS
CEIMLNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKTEFQMRLLWGSKGAQV
NQTERYEKFNQILTALSRKLEPPPVKQAELLEHHHHHH
>3t6a_D mol:protein length:333  Breast cancer anti-estrogen resistance protein 3
MGEFVTPLLETVSSFRPNEFESKFLPPENKPLETALLKRAKELFTNNDPKVIAQHVLSM
DCRVARILGVSEEMRRNMGVSSGLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTG
TLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQITRLEKTWTALRHQYTQTA
ILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQS
CEIMLNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKTEFQMRLLWGSKGAQV
NQTERYEKFNQILTALSRKLEPPPVKQAELLEHHHHHH