>3u9j_B mol:protein length:160  F-box/LRR-repeat protein 5
MAPFPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQ
IENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEA
FTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCS