>3v5i_J mol:protein length:203  ATP-dependent Clp protease proteolytic subunit
MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKD
IYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAAAMGSFLLAAGAKGKRFALPNA
EVMIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTA
EEAKEYGLIDEVMVPETKWSHPQFEK