>4bdw_A mol:protein length:85  COAGULATION FACTOR XIIA HEAVY CHAIN
GSEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRTNPCLHGGRC
LEVEGHRLCHCPVGYTGPFCDVDTAA