>4cym_C mol:protein length:230  RAS-RELATED PROTEIN RAB-32
GPLGSMAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHY
RATIGVDFALKVLNWDSRTLVRLQLWDIAGLERFGNMTRVYYKEAVGAFVVFDISRSST
FEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFE
TSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC
>4cym_A mol:protein length:230  RAS-RELATED PROTEIN RAB-32
GPLGSMAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHY
RATIGVDFALKVLNWDSRTLVRLQLWDIAGLERFGNMTRVYYKEAVGAFVVFDISRSST
FEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFE
TSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC
>4cym_F mol:protein length:203  ANKYRIN REPEAT DOMAIN-CONTAINING PROTEIN 27
GPLGSMDPSVVTPFSRDDRGHTPLHVAAVCGQASLIDLLVSKGAMVNATDYHGATPLHL
ACQKGYQSVTLLLLHYKASAEVQDNNGNTPLHLACTYGHEDCVKALVYYDVESCRLDIG
NEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKETPLKCALNSKILSVMEAYHLS
FERRQKSSEAPVQSPQRSVDHHHHHH
>4cym_E mol:protein length:203  ANKYRIN REPEAT DOMAIN-CONTAINING PROTEIN 27
GPLGSMDPSVVTPFSRDDRGHTPLHVAAVCGQASLIDLLVSKGAMVNATDYHGATPLHL
ACQKGYQSVTLLLLHYKASAEVQDNNGNTPLHLACTYGHEDCVKALVYYDVESCRLDIG
NEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKETPLKCALNSKILSVMEAYHLS
FERRQKSSEAPVQSPQRSVDHHHHHH
>4cym_B mol:protein length:230  RAS-RELATED PROTEIN RAB-32
GPLGSMAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHY
RATIGVDFALKVLNWDSRTLVRLQLWDIAGLERFGNMTRVYYKEAVGAFVVFDISRSST
FEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFE
TSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC
>4cym_F mol:protein length:203  ANKYRIN REPEAT DOMAIN-CONTAINING PROTEIN 27
GPLGSMDPSVVTPFSRDDRGHTPLHVAAVCGQASLIDLLVSKGAMVNATDYHGATPLHL
ACQKGYQSVTLLLLHYKASAEVQDNNGNTPLHLACTYGHEDCVKALVYYDVESCRLDIG
NEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKETPLKCALNSKILSVMEAYHLS
FERRQKSSEAPVQSPQRSVDHHHHHH
>4cym_D mol:protein length:203  ANKYRIN REPEAT DOMAIN-CONTAINING PROTEIN 27
GPLGSMDPSVVTPFSRDDRGHTPLHVAAVCGQASLIDLLVSKGAMVNATDYHGATPLHL
ACQKGYQSVTLLLLHYKASAEVQDNNGNTPLHLACTYGHEDCVKALVYYDVESCRLDIG
NEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKETPLKCALNSKILSVMEAYHLS
FERRQKSSEAPVQSPQRSVDHHHHHH