>4cym_D mol:protein length:203  ANKYRIN REPEAT DOMAIN-CONTAINING PROTEIN 27
GPLGSMDPSVVTPFSRDDRGHTPLHVAAVCGQASLIDLLVSKGAMVNATDYHGATPLHL
ACQKGYQSVTLLLLHYKASAEVQDNNGNTPLHLACTYGHEDCVKALVYYDVESCRLDIG
NEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKETPLKCALNSKILSVMEAYHLS
FERRQKSSEAPVQSPQRSVDHHHHHH