>4doh_A mol:protein length:153  Interleukin-20
ALKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCL
LRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKK
YSQILSHFEKLEPQAAVVKALGELDILLQWMEETE