>4doh_C mol:protein length:153  Interleukin-20
ALKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCL
LRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKK
YSQILSHFEKLEPQAAVVKALGELDILLQWMEETE