>4e9f_A mol:protein length:161  Methyl-CpG-binding domain protein 4
MLSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEK
YPSAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGND
SYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLSHHHHHH
>4e9f_D mol:na length:12  DNA (5'-D(*GP*CP*TP*GP*CP*GP*CP*GP*CP*TP*GP*G)-3')
GCTGCGCGCTGG
>4e9f_D mol:na length:12  DNA (5'-D(*GP*CP*TP*GP*CP*GP*CP*GP*CP*TP*GP*G)-3')
GCTGCGCGCTGG
>4e9f_C mol:na length:12  DNA (5'-D(*CP*CP*AP*GP*CP*GP*(3DR)P*GP*CP*AP*GP*C)-3')
CCAGCGNGCAGC