>4ihb_A mol:protein length:133  Dysferlin
GSPEFMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDL
KGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPT
GASLVLQVSYTAAAS
>4ihb_F mol:protein length:133  Dysferlin
GSPEFMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDL
KGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPT
GASLVLQVSYTAAAS
>4ihb_D mol:protein length:133  Dysferlin
GSPEFMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDL
KGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPT
GASLVLQVSYTAAAS
>4ihb_B mol:protein length:133  Dysferlin
GSPEFMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDL
KGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPT
GASLVLQVSYTAAAS
>4ihb_F mol:protein length:133  Dysferlin
GSPEFMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDL
KGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPT
GASLVLQVSYTAAAS
>4ihb_E mol:protein length:133  Dysferlin
GSPEFMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDL
KGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPT
GASLVLQVSYTAAAS
>4ihb_C mol:protein length:133  Dysferlin
GSPEFMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDL
KGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPT
GASLVLQVSYTAAAS